Place of Origin: | Hebei,China |
---|---|
Brand Name: | Xinzhou |
Certification: | COA,GMP,CQC,SGS |
Model Number: | 52232-67-4 |
Document: | Product Brochure PDF |
Minimum Order Quantity: | 1 boxes |
Price: | $200-$300/boxes |
Packaging Details: | 10mg 15mg/vial, 10 vials/box |
Delivery Time: | within 3 days |
Payment Terms: | Paypal, Western Union, Bitcoin payment, X-transfer, L/C, T/T, MoneyGram, |
Supply Ability: | 500kg/week |
Product Name: | Teriparatide Acetate | Assay: | 99%Min |
---|---|---|---|
Cas: | 52232-67-4 | Msds: | Avaliable |
Recommended Use Level: | 100-1000PPM | Sample: | Available |
Specification: | 5mg/vial,10vials/box | Texture: | Lightweight |
Highlight: | Peptide Teriparatide Acetate Power,CAS 52232-67-4 High Purity |
Product Detail
English name | Teriparatide Acetate |
Cas number | 52232-67-4 |
Synonyms |
PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF |
Purity | 99% |
Delivery time
|
within 48 hours |
Delivery | 8-12 days |
Mode of transport | Sea, air and truck transport |
Express delivery | EMS,UPS,FedEx,DHL,TNT |
USES:
A fragment of human parathyroid hormone (hPTH) peptide sequence containing the 34 N-terminal residues of hPTH. This fragment was also found to be an agonist at PTH1 and PTH2 receptors.
Teriparatide Acetate cas 52232-67-4 image:
Company Profile
Xingtai Xinzhou Technology Co., LTD.
Xingtai Xinzhou Technology Co., Ltd. was established in 2022 with strong research and development capabilities and superb synthesis technology, as well as advanced quality control measures. Effectively promote the joint venture and cooperation with the major enterprises, manufacturers, with the idea of industrial development to serve the society and the majority of users. We always adhere to the market demand as the orientation, constantly synthesizing new high-tech chemical products and medical intermediates, mainly exported to the United States, India, South Africa, Nigeria and other countries and regions, has a wealth of export experience, to ensure transportation safety, can let each customer as soon as possible to safely receive the goods.
Certificate
An ISO 9001 & GMP qualified company, we are mainly specialized in producing high quality but low price Pharmaceutical intermediates, APIs and other fine chemicals & cosmetics products which related to human
and animals medicines as well as additives in gas &oil field, almost half of the goods are for exporting. What's more, we provide the OEM (customize) manufactures, if you can't find materials from the world,
then tell us, we will research and produce in our high-tech equipmented laboratory. We are dedicated to satisfying our customers with our products and services
Packing
2. We offer convenient one-station purchasing service.
(1)Any inquiries will be replied within 12 hours.
(2)Dedication to quality, supply & service.
(3)Strictly on selecting raw materials.
(4)Reasonable & competitive price, fast lead time.
FAQ:
Q: How to confirm the product quality before placing an order
1) You can get free samples of some products, just pay the basic fee for us.
2) You can also send us the specifications or your requirements, and we will customize the product for you.
Q: How long is your delivery time
A : Generally 1-3workdays after order confirmed
Q : What is the regular MOQ for your products
A : Our MOQ starts from 1g and generally starts from 10g.For other low value product, our MOQ
starts from 100g and 1kg.
Q :How do you treat quality complaint
A : All our products are strictly tested by our QC, and confirmed by QA; unqualified material will not be released to customer.
In case any quality problem is confirmed to be caused by us, we will replace the goods or refund your payment immediately.
Q: What’s your terms of payment
A: T/T, Western Union, MoneyGram, telegraphic transfer and bitcoin